PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0327s0070.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 452aa    MW: 51450.8 Da    PI: 6.7027
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0327s0070.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS423.51.7e-129814501373
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                             l++lL++cA+a+++++ +  ++l+++ +  +s +g+p+qRl ay+ e+L ar  +s++++y++l+++e +    ++ ++++++++e+
  SapurV1A.0327s0070.3.p  81 LKQLLIACAKALDENKVNDFDKLIEKARSVVSISGEPIQRLGAYLIEGLVARKESSGTNIYHTLRCKEPE---GKDLMSYMHILYEI 164
                             689******************************************************************9...99************ PP

                    GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeel 172
                             +P+lkf++++aN aI ea ++e+r+HiiDf i qG+QW++LlqaLasRp+g+p++RiTg+++p s+  + + le+++++++ f e++
  SapurV1A.0327s0070.3.p 165 CPYLKFGYMAANGAIAEACKNEDRIHIIDFHIAQGTQWMTLLQALASRPSGAPHVRITGIDDPLSKyaRGDGLEAVARQMTAFSEKF 251
                             **************************************************************9999999****************** PP

                    GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfle 259
                             ++p+ef+  v     d++ e+++v+pgEalaVn+ l+lh+++desv+++++rd++L+++ksl+Pkvv+++eqe+++n+++Fl+rf+e
  SapurV1A.0327s0070.3.p 252 KIPIEFHG-VPVFAPDVTKEMFDVRPGEALAVNFPLELHHTPDESVDVNNPRDSLLRMIKSLNPKVVTLMEQESNTNTTPFLTRFVE 337
                             ********.6888999*********************************************************************** PP

                    GRAS 260 aleyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                             +l+yy a+f+s+++ lpr+++eri+vE+++l+r+ivnv+aceg+er+erhe l+kW++r+++aGF++ pls++ ++ +++llr ++ 
  SapurV1A.0327s0070.3.p 338 TLNYYLAIFESIDVRLPRDQKERISVEQHCLARDIVNVIACEGKEREERHELLRKWKSRFTMAGFRQWPLSSYLNSVIRSLLRCYS- 423
                             **********************************************************************************9999. PP

                    GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaW 373
                             + y++ e +g+++lgWkdr+L+s+SaW
  SapurV1A.0327s0070.3.p 424 EHYTLVEIDGAMLLGWKDRNLISASAW 450
                             66************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.67755432IPR005202Transcription factor GRAS
PfamPF035145.9E-12781450IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MGPDEDEEVN RPYISLGKTS RPQTSDQKPR VWSQERQDSH VIQTQTSFVS RQRQFGEGAH  60
VEKRQKEMEE VPLRGIPSGD LKQLLIACAK ALDENKVNDF DKLIEKARSV VSISGEPIQR  120
LGAYLIEGLV ARKESSGTNI YHTLRCKEPE GKDLMSYMHI LYEICPYLKF GYMAANGAIA  180
EACKNEDRIH IIDFHIAQGT QWMTLLQALA SRPSGAPHVR ITGIDDPLSK YARGDGLEAV  240
ARQMTAFSEK FKIPIEFHGV PVFAPDVTKE MFDVRPGEAL AVNFPLELHH TPDESVDVNN  300
PRDSLLRMIK SLNPKVVTLM EQESNTNTTP FLTRFVETLN YYLAIFESID VRLPRDQKER  360
ISVEQHCLAR DIVNVIACEG KEREERHELL RKWKSRFTMA GFRQWPLSSY LNSVIRSLLR  420
CYSEHYTLVE IDGAMLLGWK DRNLISASAW C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-62784501374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011030905.10.0PREDICTED: scarecrow-like protein 21 isoform X2
RefseqXP_011030903.10.0PREDICTED: scarecrow-like protein 21 isoform X1
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLB9I0720.0B9I072_POPTR; Uncharacterized protein
STRINGPOPTR_0011s13460.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.11e-163scarecrow-like 5